PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.BIZ8F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Dof
Protein Properties Length: 184aa    MW: 20948.2 Da    PI: 9.2341
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.BIZ8FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.8e-391269461
       zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                   +kcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk++
  Aradu.BIZ8F 12 GGVKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRR 69
                 5689***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-27868IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3291468IPR003851Zinc finger, Dof-type
PfamPF027012.6E-331468IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101652IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MERAEQQQKE KGGVKCPRCD SSNTKFCYYN NYSLSQPRHF CKACKRYWTR GGTLRNVPVG  60
GGCRKNKRRL NHPHPNTTSS QINTNNHDVN LPSLFHTFTS HAALQNNHAF AASSSSYDSI  120
LLPPASTTMM PMQQNVINGG YYCQNQMEQQ PHVPNFSDPN SLYYWSNAFT SWNNDNNHPL  180
TSLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015943077.11e-138PREDICTED: dof zinc finger protein DOF2.2-like
STRINGGSMUA_Achr9P25010_0013e-35(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.23e-34Dof family protein